PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0065ss00060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family ARR-B
Protein Properties Length: 590aa    MW: 66477.9 Da    PI: 5.0871
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0065ss00060.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like62.21e-19207256151
            G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                        k+r++W+ +LH++Fv+av+q+ G +k  Pk+il+lm+v+ Lt+e+v+SHLQ
  Vang0065ss00060.1 207 KARVVWSVDLHQKFVKAVNQI-GFDKVGPKKILDLMSVPWLTRENVASHLQ 256
                        68*******************.9***************************9 PP

2Response_reg821.8e-27271351109
                        EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHH CS
       Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedaleal 90 
                        vl+vdD+p+ +++l+++l+k  y ev+++  ++eal++l+e++  +D+++ D++mp+mdG++ll++   e  +lp+i+++  ge + + + +
  Vang0065ss00060.1  27 VLVVDDDPTWLRILEKMLKKCLY-EVTTCCLATEALKKLRERKdaYDIVISDVNMPDMDGFKLLEQVGLEM-DLPVIMMSVDGETSRVMKGV 116
                        89*********************.***************888889**********************6644.8******************* PP

                        HTTESEEEESS--HHHHHH CS
       Response_reg  91 kaGakdflsKpfdpeelvk 109
                        + Ga d+l Kp+ ++el++
  Vang0065ss00060.1 117 QHGACDYLLKPIRMKELRN 135
                        ****************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23005.6E-4424163No hitNo description
SuperFamilySSF521723.13E-3524152IPR011006CheY-like superfamily
SMARTSM004485.0E-3225137IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.88626141IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.2E-2427136IPR001789Signal transduction response regulator, receiver domain
CDDcd001565.79E-3028141No hitNo description
SuperFamilySSF466894.66E-13205257IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.0E-21205275IPR009057Homeodomain-like
TIGRFAMsTIGR015573.3E-18207256IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 590 aa     Download sequence    Send to blast
MTLLSKSMDN GCFSSPRHEA FPAGLRVLVV DDDPTWLRIL EKMLKKCLYE VTTCCLATEA  60
LKKLRERKDA YDIVISDVNM PDMDGFKLLE QVGLEMDLPV IMMSVDGETS RVMKGVQHGA  120
CDYLLKPIRM KELRNIWQHV FRKRMHEARD FESHEGFEAL HLLMNGSDQS DDGNIFAVEE  180
ITSIKKRKDA DSKHDDKEFG DHSPTKKARV VWSVDLHQKF VKAVNQIGFD KVGPKKILDL  240
MSVPWLTREN VASHLQGSLM RKKFILQKYR LYLSRLQKEN DQKSSSSGVK HSDSPSKDPG  300
SFSFLNTASN KQQSDVVIDS FSHSDESLLQ MDAPSHEGDL KRILSEPTTE KRRSSPKSSQ  360
MSLNQPFSSV ESSEASHAIF DCTIQTQYSW GEFPKGPLKE EQKTTVQLED SFSQLPLHGT  420
RHPIQVDQSQ SIASINSNPS ITEEEVAPSL DTKTLYAGYK SDYVSPVSSM GTVVDTFPKQ  480
SKSLIPNDQS PEPIFTSNLG LKTDGFDVDC ISDLDFYQRN LLLCGDAASA PLEEDLNFFL  540
LQTEWYNMNF GQQNIDISEC YDPRLVAEAP GYFYDSADYS SVDQSLFIA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-14206256454ARR10-B
3t6k_B3e-13271337114Response regulator receiver
3t6k_A3e-13271337114Response regulator receiver
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014506928.10.0PREDICTED: two-component response regulator ARR11-like
TrEMBLA0A0S3R1920.0A0A0S3R192_PHAAN; Uncharacterized protein
STRINGGLYMA05G27670.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39993360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67710.11e-113response regulator 11